Analytical Data
-
Gene name
ASPRV1
- Application
-
Alternative Names
ASPRV1；SASP；Retroviral-like aspartic protease 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53RT3
-
Expression Region
191-326aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSSMGKGYYLKGKIGKVPVRFLVDSGAQV SVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSLGKLK LKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGG SLEDEFDLE
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASPRV1, a novel recombinant protein derived from the Avian Staphylococcus Phage, has gained significant attention in recent years due to its potential applications in biotechnology and medicine. The increasing prevalence of antibiotic-resistant bacteria has heightened the urgency for alternative antimicrobial strategies, making ASPRV1 particularly relevant. This protein exhibits bacteriophage-derived properties that enable it to target and disrupt specific bacterial membranes, providing a promising avenue for developing new antibacterial agents. Researchers have been exploring its role in disrupting biofilms and its effectiveness against various pathogenic strains, which could offer a powerful tool in combating resistant infections. Furthermore, the implications of ASPRV1 extend beyond direct antimicrobial effects; its unique structural characteristics may pave the way for advancements in synthetic biology, drug delivery systems, and vaccine development. The ongoing studies focus on optimizing its production, elucidating its mechanism of action, and assessing its safety and efficacy in clinical settings, positioning ASPRV1 as a potential breakthrough in the fight against multidrug-resistant bacteria and broader applications in medical therapies.
