Analytical Data
-
Gene name
CISH
- Application
-
Alternative Names
CISH；G18；Cytokine-inducible SH2-containing Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NSE2
-
Expression Region
1-258aa
-
AA Sequence
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGT PAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMP EGTFLVRDSTHPSYLFTLSVKTTRGPTNVCIEYADSSFRLDSNCLSRPRI LAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAP PPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMAGY LRQYPFQL
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CISH (Cytokine-Inducible SH2-containing protein) is a critical regulator of cytokine signaling pathways and plays a significant role in immune system modulation. It belongs to the SOCS (Suppressors of Cytokine Signaling) family, which is known for its function in inhibiting cytokine receptor signaling, thus preventing excessive immune responses. The interest in CISH recombinant protein has surged due to its potential implications in various diseases, including autoimmunity, cancer, and infectious diseases. Researchers are investigating CISH's mechanisms of action, particularly how it interacts with signaling molecules and influences cellular responses to cytokines. Recombinant CISH proteins facilitate these studies by allowing for the examination of its functional roles in controlled experimental settings, enabling the dissection of its pathways and effects on immune cell differentiation and function. Moreover, preliminary studies suggest that modulating CISH expression or activity could serve as a therapeutic avenue for restoring balance in dysregulated immune responses. Consequently, understanding CISH at the molecular level through recombinant protein studies holds promise for developing targeted interventions in immune-related conditions, highlighting the importance of continued research in this field.
