Analytical Data
-
Gene name
CD37
- Application
-
Alternative Names
CD37；TSPAN26；Leukocyte antigen CD37
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11049
-
Expression Region
112-241aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSQ RAQLERSLRDVVEKTIQKYGTNPE ETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLS ATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQ KWLHNN
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD37 is a member of the tetraspanin family of proteins, which play crucial roles in various cell functions, including immune responses, cell adhesion, and signaling. As a glycoprotein primarily expressed on the surface of leukocytes, CD37 is implicated in regulating B cell activation and proliferation, making it particularly relevant in the context of autoimmune diseases and lymphoma. Research has shown that CD37 interacts with various receptors and other membrane proteins, which can influence cellular behavior and immune responses. Given its significant involvement in the immune system, CD37 is being investigated as a potential therapeutic target for treating cancers, especially B cell malignancies. The production of recombinant CD37 protein allows for detailed studies on its structure, function, and interactions, facilitating the development of targeted therapies and improving our understanding of its role in disease processes. This research is essential for the advancement of immunotherapeutic strategies and the design of new drugs aimed at modulating immune responses for pathological conditions.
