Analytical Data
-
Gene name
CD300E
- Application
-
Alternative Names
CD300E；CD300LE；CLM2；CMRF35A5；CMRF35-like molecule 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q496F6
-
Expression Region
18-173aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSLKGPGSVTGTAGDSLTVWCQYESMYKG YNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNL NEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHPATPP IFLVVNPGRNLSTGEVLTQNSGFRLSSPH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD300E is an immune receptor that belongs to the CD300 family of receptors, which plays a critical role in regulating immune responses. This receptor is primarily expressed on myeloid cells, including dendritic cells, macrophages, and neutrophils. Research has indicated that CD300E can modulate the activation, maturation, and function of these immune cells, influencing processes such as phagocytosis, cytokine production, and cell migration. The significance of CD300E in autoimmune diseases, infections, and cancer has drawn attention from the scientific community, as it may serve as a potential therapeutic target. Recombination technology has enabled the production of CD300E recombinant proteins, facilitating structural and functional studies to elucidate its role in immune regulation. Characterizing the biochemical properties of CD300E, including its interactions with ligands and other signaling pathways, could pave the way for new immunotherapeutic strategies aimed at harnessing or disrupting its function in pathological conditions. Overall, the study of CD300E recombinant proteins is critical for advancing our understanding of immune mechanisms and developing novel interventions for various diseases.
