Analytical Data
-
Gene name
CD9
- Application
-
Alternative Names
CD9;MIC3;TSPAN29;CD9 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21926
-
Expression Region
112-195aa
-
AA Sequence
SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQ FISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD9 is a membrane protein that belongs to the tetraspanin family, playing a vital role in various cellular processes such as cell adhesion, migration, and signaling. Its importance has been underscored in numerous studies, revealing its involvement in immune responses, cancer progression, and cell differentiation. In the context of cancer, CD9 is known to act as a tumor suppressor, influencing metastasis and invasion of tumor cells. Moreover, it has been recognized for its potential as a biomarker for several malignancies, making it a target of interest for therapeutic interventions. The study of CD9 recombinant protein has become a focal point in biomedical research, as it can aid in understanding its functional mechanisms and interactions with other cellular components. By producing CD9 in a recombinant form, researchers can investigate its properties in vitro, explore its role in cell signaling pathways, and evaluate its potential as a target for drug development and diagnostic purposes. This research not only enhances our comprehension of CD9's biological functions but also paves the way for innovative strategies in treating diseases where CD9 is implicated.











