Analytical Data
-
Gene name
CDC34
- Application
-
Alternative Names
CDC34；UBCH3；UBE2R1；Ubiquitin-conjugating enzyme E2 R1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49427
-
Expression Region
1-236aa
-
AA Sequence
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPN TYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPP VDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRK WKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPD EGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC34 is a crucial component of the ubiquitin-proteasome pathway, which plays a significant role in regulating protein degradation and cell cycle progression. As an E2 ubiquitin-conjugating enzyme, CDC34 facilitates the transfer of ubiquitin moieties to target proteins, marking them for proteasomal degradation. This process is vital for maintaining cellular homeostasis and ensuring proper cellular responses to various stimuli. Abnormalities in the CDC34 function are associated with multiple diseases, including cancer, where dysregulated protein degradation contributes to uncontrolled cell proliferation. The study of CDC34 recombinant proteins is essential for understanding its functional mechanisms and interactions with other cellular components. By generating and analyzing CDC34 in a recombinant form, researchers can investigate its enzymatic activity, binding partners, and structural properties in detail. This research not only sheds light on the molecular underpinnings of CDC34-related pathways but also paves the way for potential therapeutic interventions targeting the ubiquitin-proteasome system in diseases linked to CDC34 dysfunction. Overall, understanding CDC34's role in cellular regulation is critical for elucidating its contributions to health and disease.
