Cat: PA1000-9276

Recombinant Human NPY2R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPY2R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPY2R;Neuropeptide Y receptor type 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49146

  • Expression Region

    1-381aa

  • AA Sequence

    MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQ VVLILAYCSIILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVN TLCLPFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHR CIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEI VACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYTRIWSKLKNHV SPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIH SEVSVTFKAKKNLEVRKNSGPNDSFTEATNV

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPY2R (Neuropeptide Y receptor Y2) is a G-protein-coupled receptor that plays a crucial role in regulating various physiological processes, including appetite control, energy homeostasis, and neuroendocrine functions. The interest in NPY2R has grown due to its involvement in obesity, anxiety, and depression, making it a potential target for therapeutic interventions. Research indicates that NPY2R mediates the effects of neuropeptide Y (NPY), which is a neurotransmitter involved in stimulating food intake and promoting fat storage. Understanding the structure and function of NPY2R can provide valuable insights into its mechanistic role in these pathways. The expression of recombinant NPY2R proteins allows researchers to study the receptor's pharmacological properties, signaling mechanisms, and interactions with ligand molecules, thereby aiding in drug discovery efforts. Investigating the receptor's behavior in different cellular contexts can lead to the identification of novel therapeutic compounds that can modulate NPY2R activity, potentially offering new strategies for treating metabolic and mood disorders. Overall, the study of NPY2R recombinant proteins is pivotal for elucidating the biological roles of this receptor and developing innovative treatment approaches in the context of related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US