Analytical Data
-
Gene name
CEACAM21
- Application
-
Alternative Names
CEACAM21；Carcinoembryonic antigen-related cell adhesion molecule 21
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3KPI0
-
Expression Region
35-240aa
-
AA Sequence
WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVI DTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQA SHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRL QVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKS DDNTLGVDHHHHHH
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEACAM21, a member of the carcinoembryonic antigen (CEA) family, is primarily expressed in human epithelial tissues and has been implicated in various physiological and pathological processes, including immune regulation and tumor progression. The study of CEACAM21 recombinant protein has gained traction due to its potential role in cancer biology and immunology. Researchers aim to understand its structure, function, and interactions with other proteins, as alterations in CEACAM21 expression have been linked to several cancers, impacting patient prognosis and therapeutic responses. Additionally, CEACAM21's involvement in cell adhesion processes and its ability to modulate immune responses render it a potential target for novel therapeutic strategies. The generation of recombinant CEACAM21 proteins allows for in-depth studies of its biological functions, interactions, and mechanisms of action, thereby paving the way for potential applications in cancer diagnosis and treatment. The advancement of recombinant protein technology further facilitates high-yield production and purification of CEACAM21, enabling extensive research on its biochemical properties and therapeutic potential. Understanding CEACAM21 offers insights into the complex interplay between tumor cells and the immune system, contributing to the development of innovative cancer therapies and diagnostic tools. As investigations into CEACAM21 progress, its characterization may provide significant contributions to the broader field of cancer research and immunotherapy, highlighting the importance of this protein in the quest for effective cancer management strategies.
