Analytical Data
-
Gene name
NRG2
- Application
-
Alternative Names
NRG2；NTAK；Pro-neuregulin-2. membrane-bound isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14511
-
Expression Region
112-405aa
-
AA Sequence
CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR
-
Molecular Weight
34.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRG2 (Neuregulin-2) is a member of the neuregulin family of proteins, which are essential in various biological processes, including neural development, synaptic plasticity, and cardiac function. Neuregulins interact with receptor tyrosine kinases such as ErbB, leading to significant signaling pathways that modulate cellular behaviors. Research into NRG2 has gained traction due to its potential implications in neurological disorders, including schizophrenia and neurodevelopmental delays, as well as its role in cancer progression. Additionally, NRG2 is believed to influence the differentiation and survival of neuronal and glial cells. Despite its importance, the structural and functional characteristics of NRG2 remain less well-understood compared to other neuregulins. The generation of recombinant NRG2 protein enables researchers to conduct detailed studies on its receptor interactions, biological activity, and signaling mechanisms. Understanding the precise role of NRG2 in cellular processes could provide insights into its therapeutic potential and broaden our knowledge of neuregulin-related pathways involved in health and disease. Therefore, the study of recombinant NRG2 is crucial for unveiling its molecular functions and exploring its impact on key physiological and pathological processes.
