Cat: PA1000-9277

Recombinant Human NPY5R Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NPY5R

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NPY5R;NPYR5;Neuropeptide Y receptor type 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15761

  • Expression Region

    1-445aa

  • AA Sequence

    MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTF VSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLT SVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNN LTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVE SWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLE ENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHEL RVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISN RHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NPY5R, or Neuropeptide Y receptor Y5, is a member of the neuropeptide Y receptor family, which plays a crucial role in various physiological processes, including the regulation of appetite, energy homeostasis, and stress responses. The receptor is primarily expressed in the brain and peripheral tissues, indicating its involvement in neuroendocrine functions. Research has shown that NPY5R is implicated in obesity and metabolic disorders due to its influence on food intake and energy expenditure. The study of recombinant NPY5R proteins is essential for understanding its structure, function, and interactions with various ligands. By producing and characterizing these recombinant proteins, scientists aim to elucidate the signaling pathways activated by NPY5R, which could lead to potential therapeutic targets for obesity and related metabolic diseases. Moreover, the knowledge gained from NPY5R research may provide insights into neuropsychiatric disorders where neuropeptide signaling is disrupted. Overall, the investigation of NPY5R recombinant proteins represents a promising approach to decipher the complexities of neuropeptide signaling and its implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US