Cat: PA1000-565DB

Recombinant Human CDKN2C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDKN2C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDKN2C;CDKN6;Cyclin-dependent kinase 4 inhibitor C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42773

  • Expression Region

    1-168aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVN VNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARA GFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNV GHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDKN2C, also known as p18INK4c, is a crucial cyclin-dependent kinase inhibitor that plays a significant role in regulating the cell cycle, specifically by inhibiting the activity of cyclin-dependent kinases 4 and 6 (CDK4 and CDK6). Its primary function is to ensure that cells do not progress from the G1 phase to the S phase of the cell cycle, thereby preventing uncontrolled cell proliferation. Deregulation or mutation of CDKN2C has been implicated in various cancers, particularly in hematological malignancies and solid tumors, highlighting its potential as a tumor suppressor gene. Research on CDKN2C often focuses on understanding its structural properties, regulatory mechanisms, and how its dysfunction contributes to tumorigenesis. The pursuit of recombinant CDKN2C protein is vital for detailed biochemical studies and therapeutic application, as it enables researchers to elucidate its role in cell cycle regulation, investigate interactions with other cell cycle proteins, and explore potential avenues for cancer treatment. By producing and characterizing this recombinant protein, scientists can develop assays that may reveal novel insights into its function, paving the way for targeted therapies that could manipulate CDKN2C pathways in cancer cells. Moreover, understanding the molecular dynamics of CDKN2C can shed light on the development of resistance to existing therapies, making it a key focus in cancer research. Overall, CDKN2C represents a significant target for further investigation, with implications for improving cancer diagnosis, prognosis, and treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US