Analytical Data
-
Gene name
CDKN2C
- Application
-
Alternative Names
CDKN2C;CDKN6;Cyclin-dependent kinase 4 inhibitor C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42773
-
Expression Region
1-168aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVN VNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARA GFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNV GHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKN2C, also known as p18INK4c, is a crucial cyclin-dependent kinase inhibitor that plays a significant role in regulating the cell cycle, specifically by inhibiting the activity of cyclin-dependent kinases 4 and 6 (CDK4 and CDK6). Its primary function is to ensure that cells do not progress from the G1 phase to the S phase of the cell cycle, thereby preventing uncontrolled cell proliferation. Deregulation or mutation of CDKN2C has been implicated in various cancers, particularly in hematological malignancies and solid tumors, highlighting its potential as a tumor suppressor gene. Research on CDKN2C often focuses on understanding its structural properties, regulatory mechanisms, and how its dysfunction contributes to tumorigenesis. The pursuit of recombinant CDKN2C protein is vital for detailed biochemical studies and therapeutic application, as it enables researchers to elucidate its role in cell cycle regulation, investigate interactions with other cell cycle proteins, and explore potential avenues for cancer treatment. By producing and characterizing this recombinant protein, scientists can develop assays that may reveal novel insights into its function, paving the way for targeted therapies that could manipulate CDKN2C pathways in cancer cells. Moreover, understanding the molecular dynamics of CDKN2C can shed light on the development of resistance to existing therapies, making it a key focus in cancer research. Overall, CDKN2C represents a significant target for further investigation, with implications for improving cancer diagnosis, prognosis, and treatment strategies.











