Cat: PA1000-567DB

Recombinant Human CEACAM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CEACAM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CEACAM1;BGP;BGP1;Carcinoembryonic antigen-related cell adhesion molecule 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13688

  • Expression Region

    35-428aa

  • AA Sequence

    QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAI GTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEA TGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQS LPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVT YGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQEL FIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASK TTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSIN PVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGVDHHHH HH

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1) is a member of the CEACAM family of proteins, which are involved in various biological processes, including cell adhesion, immune response, and tumor progression. Its expression is often upregulated in various tumors, making it a potential biomarker for cancer diagnosis and therapy. The study of CEACAM1 recombinant protein has attracted significant attention due to its critical role in mediating interactions between immune cells and tumor cells, influencing cancer metastasis and immune evasion. Research has shown that CEACAM1 can modulate T cell responses and angiogenesis, further emphasizing its potential as a therapeutic target. Furthermore, understanding the structural and functional properties of CEACAM1 through recombinant protein production can provide insights into its mechanisms of action, paving the way for the development of CEACAM1-based therapeutics and diagnostic tools. As researchers seek to harness its properties for clinical applications, generating high-quality recombinant CEACAM1 is essential for studying its interactions and effects in both preclinical and clinical settings. Overall, CEACAM1 stands out as a significant protein in cancer biology, making its recombinant form a valuable resource for further exploration in the fields of immunology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US