Cat: PA1000-9282

Recombinant Human CERK Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CERK

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CERK;KIAA1646;Ceramide kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TCT0

  • Expression Region

    1-537aa

  • AA Sequence

    MGATGAAEPLQSVLWVKQQRCAVSLEPARALLRWWRSPGPGAGAPGADAC SVPVSEIIAVEETDVHGKHQGSGKWQKMEKPYAFTVHCVKRARRHRWKWA QVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPFGGKGQGKRIY ERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMF SEVLHGLIGRTQRSAGVDQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVG TSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDS EKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAG CFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCAC RRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFV EVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWN CDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CERK (chitinase-like domain-containing protein) is an important protein that plays a crucial role in plant defense and immune responses against pathogens. Research on CERK and its recombinant forms has gained significant attention due to their potential applications in biotechnology and agriculture. The protein is known to recognize chitin, a component of fungal cell walls, and subsequently activate defense mechanisms in plants, such as the production of reactive oxygen species and the expression of pathogenesis-related genes. Understanding the structure and function of CERK is essential for developing crops with enhanced resistance to diseases, which is particularly relevant in the context of global food security and sustainable agriculture. Recent studies have focused on the recombinant expression of CERK to delve deeper into its biochemical properties and interaction mechanisms. By producing CERK proteins in heterologous systems, researchers aim to elucidate the signaling pathways activated during pathogen attacks and the molecular interactions involved in plant immunity. Furthermore, insights gained from recombinant CERK studies could facilitate the engineering of resistant crops and the development of novel biopesticides, thereby reducing reliance on chemical pesticides and promoting environmentally friendly farming practices. Ultimately, ongoing research on CERK and its recombinant forms holds promise for advancing our understanding of plant-pathogen interactions and enhancing crop resilience in an era of climate change and increasing agricultural challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US