Analytical Data
-
Gene name
CEACAM3
- Application
-
Alternative Names
CEACAM3；CD66D；CGM1；Carcinoembryonic antigen-related cell adhesion molecule 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P40198
-
Expression Region
35-155aa
-
AA Sequence
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVI GTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEA TGQFHVYQENAPGLPVGAVAGVDHHHHHH
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEACAM3 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3) is a member of the CEACAM family of proteins that play significant roles in immune regulation and pathogen recognition. Research into CEACAM3 has gained momentum due to its potential implications in various diseases, particularly cancers and infections. It is primarily expressed on human neutrophils and has been shown to mediate immune responses against bacterial pathogens by facilitating phagocytosis and influencing cytokine production. The study of recombinant CEACAM3 proteins aims to elucidate their structural and functional properties, which can provide insights into their mechanisms of action. Furthermore, as a target for immunotherapy, understanding the interactions and signaling pathways involving CEACAM3 could lead to novel therapeutic strategies for enhancing immune responses against pathogens and cancer cells. Additionally, recombinant CEACAM3 can serve as a valuable tool for studying CEACAM family interactions and their roles in cellular adhesion processes. As such, the exploration of CEACAM3 and its recombinant forms is critical for advancing our knowledge of immune response mechanisms and developing effective interventions in immune-related diseases.
