Analytical Data
-
Gene name
CECR1
- Application
-
Alternative Names
CECR1；ADGF；CECR1；IDGFL；Adenosine deaminase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZK5
-
Expression Region
254-453aa
-
AA Sequence
ELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSY
-
Molecular Weight
57.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CECR1, or Cat Eye Syndrome Chromosome Region 1, is a gene that encodes a protein involved in various biological processes, including DNA repair, apoptosis, and regulation of gene expression. Mutations or dysregulation of CECR1 have been associated with multiple developmental disorders, particularly the Cat Eye Syndrome, which primarily results in ocular anomalies, cardiac defects, and other phenotypic abnormalities. Research on recombinant CECR1 protein has gained significant attention due to its potential role in understanding the mechanisms underlying these disorders and its implications in cellular pathways. By studying the structure and function of CECR1, scientists aim to elucidate its interactions with other cellular components, contributing to the development of targeted therapeutic strategies. Moreover, the recombinant form of CECR1 allows for the exploration of its enzymatic activities and binding properties in vitro, facilitating deeper insights into its physiological functions. As such, investigations into CECR1 not only enhance our comprehension of the genetic basis of related syndromes but also highlight its significance in broader biological contexts, paving the way for innovative approaches in genetic disease management and gene therapy.
