Cat: PA1000-575DB

Recombinant Human VAMP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VAMP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VAMP3;SYB3;Vesicle-associated membrane Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15836

  • Expression Region

    1-100aa

  • AA Sequence

    MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VAMP3 (Vesicle-Associated Membrane Protein 3), also known as Synaptobrevin-3, is a member of the SNARE (Soluble N-ethylmaleimide Sensitive Factor Attachment Protein Receptor) protein family, which plays a pivotal role in intracellular membrane trafficking and neurotransmitter release. Research into VAMP3 has grown significantly due to its essential function in exocytosis, particularly in neuronal and endocrine cells where it facilitates the fusion of synaptic vesicles with the plasma membrane. This process is crucial for the release of neurotransmitters, influencing synaptic communication and various physiological responses. The study of VAMP3 and its interactions with other SNARE proteins, such as syntaxins and SNAPs, enhances our understanding of the molecular machinery underlying vesicle transport and fusion. Additionally, VAMP3 is implicated in various pathological states, including neurodegenerative disorders and metabolic diseases, making it a potential therapeutic target. Recombinant VAMP3 proteins can be generated for in vitro studies to investigate its structure, binding partners, and functions, thereby contributing to a wider understanding of synaptic dynamics and cellular signaling pathways. Overall, the exploration of VAMP3 as a recombinant protein not only elucidates fundamental biological processes but also opens avenues for developing novel therapeutic strategies in neurology and beyond.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US