Analytical Data
-
Gene name
NPNT
- Application
-
Alternative Names
NPNT；EGFL6L；POEM；Nephronectin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y639
-
Expression Region
29-220aa
-
AA Sequence
QNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSAT RKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHK RSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINK ENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHVDHHHHHH
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NPNT (Nephron Progenitor-Niche Transcription Factor) is a critical protein involved in kidney development and nephron formation. The study of NPNT is particularly important due to its role in regulating nephrogenesis, the process by which nephrons, the functional units of the kidney, are formed. Understanding NPNT's function and mechanism offers insights into kidney biology and potential implications for regenerative medicine and treatment of renal diseases. Recent research has highlighted NPNT's involvement in the signaling pathways that govern cell differentiation and proliferation in the nephron progenitor niche. Investigating the dynamics of NPNT expression and its interaction with other key factors within the kidney microenvironment can pave the way for new therapeutic strategies aimed at enhancing kidney repair or regeneration in the context of conditions such as congenital disorders or chronic kidney disease. Thus, NPNT serves as a promising target for further exploration in the fields of developmental biology and nephrology, where its manipulation could lead to innovative approaches to kidney health and disease management.
