Cat: PA1000-9329

Recombinant Human ECRG4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ECRG4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ECRG4;C2orf40;Augurin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H1Z8

  • Expression Region

    71-132aa

  • AA Sequence

    QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR

  • Molecular Weight

    12.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ECRG4, or Enhanced Cysteine-Rich Secretory Protein 4, is a member of the cysteine-rich protein family that has garnered attention for its potential role in cancer biology and other diseases. Initially identified through differential expression studies, ECRG4 has been implicated in tumor suppression and regulation of cell proliferation, particularly in various cancer types such as gastric and colorectal cancers. Research indicates that ECRG4 may function as a tumor suppressor by modulating signaling pathways involved in cell growth and survival, consequently affecting tumor development and metastasis. Additionally, its expression levels have been correlated with patient prognosis, suggesting that ECRG4 could serve as a biomarker for cancer diagnosis and treatment response. The recombinant production of ECRG4 protein allows for detailed structural and functional studies, facilitating insights into its biological mechanisms and potential therapeutic applications. Investigating ECRG4 in a recombinant form also supports the exploration of its interactions with other cellular proteins, paving the way for novel cancer therapies targeting this pathway. Overall, understanding the role of ECRG4 through recombinant protein studies is significant not only for elucidating the underlying mechanisms of oncogenesis but also for developing innovative diagnostic and therapeutic strategies in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US