Analytical Data
-
Gene name
ECRG4
- Application
-
Alternative Names
ECRG4;C2orf40;Augurin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1Z8
-
Expression Region
71-132aa
-
AA Sequence
QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR
-
Molecular Weight
12.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECRG4, or Enhanced Cysteine-Rich Secretory Protein 4, is a member of the cysteine-rich protein family that has garnered attention for its potential role in cancer biology and other diseases. Initially identified through differential expression studies, ECRG4 has been implicated in tumor suppression and regulation of cell proliferation, particularly in various cancer types such as gastric and colorectal cancers. Research indicates that ECRG4 may function as a tumor suppressor by modulating signaling pathways involved in cell growth and survival, consequently affecting tumor development and metastasis. Additionally, its expression levels have been correlated with patient prognosis, suggesting that ECRG4 could serve as a biomarker for cancer diagnosis and treatment response. The recombinant production of ECRG4 protein allows for detailed structural and functional studies, facilitating insights into its biological mechanisms and potential therapeutic applications. Investigating ECRG4 in a recombinant form also supports the exploration of its interactions with other cellular proteins, paving the way for novel cancer therapies targeting this pathway. Overall, understanding the role of ECRG4 through recombinant protein studies is significant not only for elucidating the underlying mechanisms of oncogenesis but also for developing innovative diagnostic and therapeutic strategies in oncology.











