Analytical Data
-
Gene name
CLIC1
- Application
-
Alternative Names
CLIC1；G6；NCC27；Chloride intracellular channel Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00299
-
Expression Region
1-241aa
-
AA Sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC1, or Chloride Intracellular Channel 1, is a member of the CLIC protein family known for its role in regulating cellular chloride ion transport, which is crucial for maintaining cellular homeostasis and physiological processes. Research over the years has demonstrated that CLIC1 is not only involved in ion transport but also plays a significant role in various pathophysiological conditions, including cancer, where its expression is often associated with tumor progression and metastasis. Notably, CLIC1 exists in both soluble and membrane-bound forms, which suggests its diverse functional roles in different cellular contexts. Recent studies have highlighted the potential of CLIC1 as a therapeutic target, given its involvement in diseases such as lung cancer and neurodegenerative disorders. The investigation of CLIC1 recombinant proteins has opened new avenues for understanding its structural properties, functional mechanisms, and interactions with other cellular components. Recombinant CLIC1 proteins enable researchers to analyze the protein’s characteristics in detail, assess its ion channel activity, and explore how its dysregulation can impact cellular functions. This research is critical for elucidating the biological significance of CLIC1 and for developing targeted strategies to manipulate its function in therapeutic contexts. Overall, the study of CLIC1 recombinant proteins is paving the way for novel insights into chloride channel biology and its implications in health and disease.
