Cat: PA1000-690DB

Recombinant Human COPE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COPE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COPE;Coatomer subunit epsilon

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14579

  • Expression Region

    1-308aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAPPAPGPASGGSGEVDELFDVKNAFY IGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKPSS APELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIY LHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDE DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHM AQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQL KDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COPE (Cytosolic Oligomeric Protein Exosome) is a crucial protein involved in various cellular processes, including membrane trafficking, secretion, and cytoskeletal organization. It plays a significant role in maintaining cellular homeostasis by regulating the transport of proteins and lipids within the cell. Recent studies have highlighted its involvement in pathophysiological conditions, such as neurodegenerative diseases and cancer, where its dysregulation can lead to altered cellular functions and contribute to disease progression. The structural characterization of COPE, particularly its oligomeric states, provides insights into its functional mechanisms and interactions with other cellular components. By employing advanced techniques like cryo-electron microscopy and nuclear magnetic resonance spectroscopy, researchers aim to elucidate the dynamics of COPE assembly and its functional implications in the cell. Understanding the biochemical pathways involving COPE could pave the way for novel therapeutic strategies to target diseases associated with its dysfunction. Therefore, the study of COPE not only enhances our fundamental knowledge of cellular biology but also opens avenues for developing interventions in various human diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US