Analytical Data
-
Gene name
CCR5
- Application
-
Alternative Names
CCR5；CMKBR5；C-C chemokine receptor type 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51681
-
Expression Region
1-352aa
-
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
-
Molecular Weight
42.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR5 (C-C chemokine receptor type 5) is a critical co-receptor for HIV-1 entry into host cells, making it a pivotal target in the development of therapeutic strategies against HIV/AIDS. Research into CCR5 has gained significant momentum due to its role in facilitating viral infection and its correlation with the progression of HIV. The discovery that individuals with a specific mutation in the CCR5 gene (CCR5-Δ32) exhibit resistance to HIV has spurred interest in targeting CCR5 for both gene therapy and drug development. Additionally, CCR5 antagonists, such as Maraviroc, have been developed and are used in clinical settings to block HIV-1 entry, showcasing the receptor's therapeutic potential. Beyond HIV, CCR5 is implicated in various inflammatory and autoimmune disorders, further expanding the scope of research. The recombination and expression of CCR5 protein have enabled scientists to study its structure, function, and interactions with HIV and other ligands. Through techniques like protein crystallography and mutagenesis, researchers aim to elucidate the mechanisms by which CCR5 facilitates viral entry, paving the way for novel interventions. Overall, the ongoing exploration of CCR5 recombinant protein is crucial not only for understanding HIV pathogenesis but also for the broader context of immune responses and potential therapeutic applications.
