Analytical Data
-
Gene name
CCR4
- Application
-
Alternative Names
CCR4；CMKBR4；C-C chemokine receptor type 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51679
-
Expression Region
1-360aa
-
AA Sequence
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVF VFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAA DQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRART LTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKV LSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVL FLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQS TMDHDLHDAL
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR4 (C-C chemokine receptor type 4) is a G protein-coupled receptor that plays a crucial role in immune system regulation, particularly in the migration and differentiation of T cells. It is primarily expressed in lymphocytes and is involved in directing the migration of these immune cells to sites of inflammation, thereby playing a significant role in various immune responses. Recent studies have highlighted CCR4's involvement not only in normal immune function but also in pathological conditions such as allergies, autoimmune diseases, and cancer. For instance, CCR4 is known to be highly expressed in certain types of tumors, correlating with poor prognosis and disease progression, making it an attractive target for immunotherapy. The development of CCR4-recombinant proteins allows researchers to better understand its biochemical pathways and interactions, aiding the design of targeted therapies and monoclonal antibodies. By studying these recombinant proteins, scientists aim to delineate the precise mechanisms through which CCR4 influences immune cell behavior and disease outcomes. This research is pivotal for advancing therapeutic strategies aimed at modulating immune responses in various clinical contexts, particularly in oncology and chronic inflammatory diseases. Thus, CCR4 and its recombinant forms are at the forefront of investigations that could lead to novel treatments and improved patient outcomes.
