Analytical Data
-
Gene name
RUVBL2
- Application
-
Alternative Names
RUVBL2；INO80H；NMP238；TIP49；RuvB-like 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y230
-
Expression Region
2-463aa
-
AA Sequence
ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
-
Molecular Weight
67.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RUVBL2, a member of the RuvB-like protein family, plays a crucial role in various cellular processes, including DNA repair, transcription regulation, and chromatin remodeling. Its significance has attracted considerable attention in the fields of cancer biology and molecular genetics due to its overexpression in several tumor types and its involvement in oncogenic processes. Research has demonstrated that RUVBL2 acts as a cofactor for various transcription factors and is implicated in the assembly of chromatin remodeling complexes, influencing gene expression and cellular proliferation. Additionally, studies have linked RUVBL2 to the regulation of key oncogenic pathways, such as the c-Myc and Wnt signaling pathways, further highlighting its potential as a therapeutic target. The recombinant expression of RUVBL2 allows for detailed investigation of its biochemical properties, structural characteristics, and functional roles in cellular mechanisms. Understanding RUVBL2's interactions and regulatory mechanisms at a molecular level is vital for uncovering its contribution to tumorigenesis and developing targeted therapies. Moreover, the development of specific inhibitors against RUVBL2 is an emerging area of research, aiming to exploit its critical function in cancer progression and improve therapeutic outcomes. Overall, the study of RUVBL2 in the context of recombinant protein research not only enhances our understanding of fundamental cellular processes but also paves the way for innovation in cancer treatment strategies.
