Analytical Data
-
Gene name
DLX3
- Application
-
Alternative Names
DLX3;Homeobox Protein DLX-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60479
-
Expression Region
1-186aa
-
AA Sequence
MGSSHHHHHH SSGLVPRGSH MGSMSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQ HDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGA YREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRR FQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DLX3 is a member of the Distal-less homeobox gene family, which plays a crucial role in various developmental processes, particularly in the formation of the craniofacial structure, dental tissues, and the skin. Research has shown that mutations in the DLX3 gene are associated with several genetic disorders, including Dental Enamel Hypoplasia and the Hypoparathyroidism, Deafness, and Renal Dysplasia (HDR) syndrome. Given its significant role in cellular differentiation and tissue patterning, scientists have focused on characterizing DLX3 recombinant proteins to understand its functional mechanism better. The study of DLX3 recombinant proteins allows researchers to investigate the transcriptional regulatory pathways and protein-protein interactions mediated by DLX3, which are pivotal for normal embryonic development and adult tissue homeostasis. By producing DLX3 in a recombinant form, researchers can conduct functional assays, explore its binding affinities to target genes, and evaluate its role in cellular processes such as proliferation and apoptosis. Understanding the biochemical properties and interactions of DLX3 can provide valuable insights into its contribution to developmental anomalies and may pave the way for potential therapeutic strategies targeting DLX3-related diseases. This research not only enhances our comprehension of DLX3's biological significance but also informs the development of engineered proteins for clinical applications, thereby holding promise for advancements in regenerative medicine and genetic therapy.
