Cat: PA1000-1043

Recombinant Human ERH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ERH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ERH;Enhancer of rudimentary homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P84090

  • Expression Region

    1-104aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNE CMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQ TYQPYNKDWIKEKIYVLLRRQAQQAGK

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of ERH (Enhancer of Rudimentary Homolog) recombinant protein is rooted in its crucial role in various biological processes, including RNA metabolism, cellular proliferation, and differentiation. ERH is a highly conserved protein across species, suggesting its fundamental importance in cellular functions. Recent research has highlighted its involvement in the regulation of gene expression and the potential mechanism of action related to cancer development and other diseases. The recombinant form of ERH facilitates detailed biochemical studies, allowing researchers to investigate its interactions with other proteins and cellular components. This research is essential for understanding the precise functions of ERH and its implications in human health. Furthermore, characterizing ERH in a recombinant form provides a valuable tool for drug discovery and the development of novel therapeutic strategies. By studying ERH, scientists aim to uncover potential biomarkers for disease progression and identify new targets for intervention, ultimately paving the way for advances in molecular medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US