Analytical Data
-
Gene name
mtb12
- Application
-
Alternative Names
mtb12;cfp2;Low molecular weight antigen MTB12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WIN7
-
Expression Region
1-168aa
-
AA Sequence
MKMVKSIAAGLTAAAAIGAAAAGVTSIMAGGPVVYQMQPVVFGAPLPLDPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN
-
Molecular Weight
16.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTB12 recombinant protein, derived from the MTB family, has garnered significant attention in the field of biochemistry and molecular biology due to its potential applications in various scientific and medical domains. Initially identified for its role in specific biological pathways, MTB12 has been implicated in processes such as protein folding, cellular stress responses, and interaction with other biomolecules. The recombinant production of MTB12 enables researchers to study its structure-function relationship in vitro, facilitating investigations into its mechanisms of action and potential therapeutic applications. Furthermore, the development of MTB12 as a recombinant protein allows for the exploration of its use as a biomarker in disease diagnosis and prognosis, as well as its potential in drug discovery and development. Advances in recombinant DNA technology, including the use of expression systems such as bacteria, yeast, or mammalian cells, have made it feasible to produce MTB12 in large quantities with high purity, further enhancing its research viability. As the scientific community continues to unveil the complexities of MTB12's biological functions, understanding its role may lead to innovative solutions for medical challenges, particularly in the context of diseases where protein misfolding or cellular stress plays a crucial role. Thus, MTB12 serves as a promising candidate for further exploration, emphasizing the need for comprehensive studies that illuminate its properties and applications in health and disease.











