Analytical Data
-
Gene name
EXOSC3
- Application
-
Alternative Names
EXOSC3；RRP40;Exosome complex component RRP40
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQT5
-
Expression Region
1-275aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAEPASVAAESLAGSRARAARTVLGQV VLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDR LLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGD IFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPE MVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPL EIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXOSC3 is a key component of the exosome complex, which is responsible for the degradation of RNA in eukaryotic cells. Its role extends beyond RNA processing; it is involved in various cellular functions, including the regulation of gene expression and the response to stress. Mutations in the EXOSC3 gene have been linked to specific neurodegenerative disorders, particularly in the context of conditions like telomere-associated dyskeratosis congenita and spinal muscular atrophy. The study of EXOSC3 and its associated pathways has garnered significant attention in molecular biology and genetics, as understanding its function and mechanisms can provide insights into the fundamental processes of RNA metabolism and the pathogenesis of related diseases. Recent advances in recombinant protein technology have facilitated the production of EXOSC3 in vitro, allowing researchers to investigate its structural and functional properties. This research is crucial for unveiling the molecular basis of the associated disorders and may lead to the development of targeted therapies. Overall, studying EXOSC3 not only enhances our understanding of RNA decay pathways but also opens new avenues for addressing genetic diseases linked to its dysfunction.
