Analytical Data
-
Gene name
IGLL5
- Application
-
Alternative Names
IGLL5；Immunoglobulin lambda-like polypeptide 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B9A064
-
Expression Region
36-214aa
-
AA Sequence
HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
-
Molecular Weight
26.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IGLL5 (Immunoglobulin Lambda-Like Polypeptide 5) is a member of the immunoglobulin superfamily, playing a crucial role in B-cell development and immune response. Recent studies have highlighted its significance in the regulation of both adaptive and innate immunity, particularly in the context of antibody production and B-cell receptor signaling. IGLL5 is expressed primarily in developing B cells, suggesting its involvement in the maturation process and selection of B-cell populations. Furthermore, its altered expression has been implicated in various hematological malignancies and autoimmune disorders, making it a potential biomarker for diagnosis and prognosis. The recombinant protein of IGLL5 allows for the in-depth study of its structural and functional properties, facilitating the exploration of its role in immune responses. By producing IGLL5 in a recombinant system, researchers can analyze its interactions with other proteins and antibodies, shedding light on its contribution to immune cell signaling pathways and potential therapeutic applications. Understanding the molecular mechanisms underlying IGLL5 function through recombinant protein studies may ultimately lead to innovative strategies for treating immune-related diseases and enhancing vaccination approaches. Overall, the research surrounding IGLL5 recombinant proteins underscores their importance in immunological research and their potential impact on future therapeutic developments.
