Cat: PA2000-3812

Recombinant Human IGLL5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGLL5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IGLL5;Immunoglobulin lambda-like polypeptide 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    B9A064

  • Expression Region

    36-214aa

  • AA Sequence

    HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

  • Molecular Weight

    26.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGLL5 (Immunoglobulin Lambda-Like Polypeptide 5) is a member of the immunoglobulin superfamily, playing a crucial role in B-cell development and immune response. Recent studies have highlighted its significance in the regulation of both adaptive and innate immunity, particularly in the context of antibody production and B-cell receptor signaling. IGLL5 is expressed primarily in developing B cells, suggesting its involvement in the maturation process and selection of B-cell populations. Furthermore, its altered expression has been implicated in various hematological malignancies and autoimmune disorders, making it a potential biomarker for diagnosis and prognosis. The recombinant protein of IGLL5 allows for the in-depth study of its structural and functional properties, facilitating the exploration of its role in immune responses. By producing IGLL5 in a recombinant system, researchers can analyze its interactions with other proteins and antibodies, shedding light on its contribution to immune cell signaling pathways and potential therapeutic applications. Understanding the molecular mechanisms underlying IGLL5 function through recombinant protein studies may ultimately lead to innovative strategies for treating immune-related diseases and enhancing vaccination approaches. Overall, the research surrounding IGLL5 recombinant proteins underscores their importance in immunological research and their potential impact on future therapeutic developments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US