Analytical Data
-
Gene name
METTL7B
- Application
-
Alternative Names
METTL7B；METTL7B；Thiol S-methyltransferase TMT1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX53
-
Expression Region
24-244aa
-
AA Sequence
LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK
-
Molecular Weight
29.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
METTL7B, a member of the methyltransferase family, has garnered attention in recent years due to its potential roles in various biological processes, including RNA methylation and gene regulation. Emerging evidence suggests that METTL7B is involved in the modification of mRNA and non-coding RNAs, influencing stability and translational efficiency, which are crucial for cellular responses to stress and developmental cues. Additionally, its dysregulation has been linked to several diseases, including cancer, where it may contribute to tumorigenesis by altering gene expression profiles. Despite its significance, the functional mechanisms of METTL7B remain poorly understood, hampering the development of targeted therapies. Researchers have pursued the production of recombinant METTL7B protein to facilitate in-depth studies on its enzymatic activity, substrate specificity, and interaction with other cellular components. This recombinant protein serves as a valuable tool for elucidating the biochemical pathways in which METTL7B is involved, as well as for exploring its potential as a therapeutic target in diseases characterized by aberrant RNA modifications. Overall, the study of METTL7B recombinant protein not only enhances our understanding of RNA biology but also opens avenues for novel interventions in related pathologies.
