Cat: PA1000-9711

Recombinant Human CX37 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CX37

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CX37;Gap junction alpha-4 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35212

  • Expression Region

    1-333aa

  • AA Sequence

    MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV

  • Molecular Weight

    37.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CX37, or connexin 37, is a member of the connexin family of proteins that form gap junctions, facilitating direct intercellular communication. Research on CX37 has gained significant attention due to its role in various physiological processes and its potential implications in disease pathogenesis, particularly in cardiovascular and cancer biology. It is predominantly expressed in vascular endothelial cells, where it plays a crucial role in maintaining endothelial function, regulating vascular permeability, and influencing angiogenesis. Studies have demonstrated that alterations in CX37 expression or function can contribute to endothelial dysfunction and have been associated with conditions such as atherosclerosis and hypertension. Moreover, CX37's involvement in tumor biology has become an emerging area of interest, as its dysregulation may affect cell proliferation, migration, and apoptosis in cancer cells. The development of recombinant CX37 proteins provides a valuable tool for further elucidating its biological functions and therapeutic potentials. By exploring the structural and functional properties of CX37 through recombinant approaches, researchers aim to understand how it interacts with other cellular components and its mechanistic pathways in both normal and pathological contexts. This knowledge is crucial for identifying potential therapeutic targets for diseases where CX37 is implicated. Thus, the investigation of CX37 recombinant proteins is not only essential for basic scientific understanding but also holds promise for translational research in developing novel interventions for cardiovascular diseases and cancer.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US