Analytical Data
-
Gene name
KA3L
- Application
-
Alternative Names
KA3L；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52539
-
Expression Region
135-364aa
-
AA Sequence
CLLTNDILETDLLLRYRQCLDSLTREENQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFEFFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSEFEVQQQTPDSFRHPIQQAMSIVVTFARILRQIKEHIIRTKKPQFIRDFDTERVAERYECGLISRLIGKQFSNHKCDDVSCQNRIERIMAPWKPSLFFCTYF
-
Molecular Weight
34.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KA3L is a recombinant protein that has garnered significant attention in the field of biotechnology and molecular biology due to its potential applications in various therapeutic and diagnostic contexts. Research into KA3L is rooted in the growing need for effective biopharmaceuticals and tools that can enhance biological processes. The protein is derived from specific genetic sequences that allow for the expression of functional proteins in host systems, such as bacteria or yeast. This recombinant technology not only provides a pathway to produce proteins in large quantities but also enables the modification of these proteins to improve their stability, efficacy, and specificity. Studies have shown that KA3L exhibits unique properties that could be beneficial for applications in areas such as targeted drug delivery, immune response modulation, and as a biological marker in disease diagnostics. Moreover, the ability to produce KA3L in a cost-effective manner enhances its feasibility for further research and application development. Ongoing investigations focus on elucidating the precise mechanisms of action of KA3L, optimizing its production processes, and exploring its interactions within biological systems. The implications of this research extend beyond academic interest, as they may lead to innovative solutions for pressing health challenges. Overall, the KA3L recombinant protein represents a promising avenue in the quest for advanced biotherapeutic agents and diagnostic tools, highlighting the intersection of molecular engineering and healthcare innovation.
