Analytical Data
-
Gene name
mip
- Application
-
Alternative Names
mip；AQP0；Lens fiber major intrinsic Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30301
-
Expression Region
1-263aa
-
AA Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL
-
Molecular Weight
29.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MIP (Membrane-Interacting Protein) recombinant proteins have garnered significant attention in the fields of biochemistry and molecular biology due to their pivotal roles in various cellular processes, including signal transduction, transport mechanisms, and cellular communication. These proteins are characterized by their ability to interact with biological membranes, which facilitates a wide range of physiological functions. Research on MIP recombinant proteins is driven by the need to understand their structure-function relationships, mechanisms of interaction with membranes, and their implications in health and disease. Furthermore, the production of MIP recombinant proteins allows for detailed studies of their functional properties and potential applications in biotechnology and medicine. These studies have opened avenues for therapeutic interventions, particularly in conditions where MIP-related pathways are disrupted. Overall, the investigation of MIP recombinant proteins is crucial for elucidating their biological significance and harnessing their potential in various scientific and medical applications.
