Cat: PA2000-8138

Recombinant Human GTF2H3 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GTF2H3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GTF2H3; General transcription factor IIH subunit 3; Basic transcription factor 2 34 kDa subunit; BTF2 p34; General transcription factor IIH polypeptide 3; TFIIH basal transcription factor complex p34 subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13889

  • Expression Region

    1-308aa

  • AA Sequence

    MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA

  • Molecular Weight

    60.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GTF2H3, a pivotal component of the transcription factor IIH (TFIIH) complex, plays a critical role in nucleotide excision repair (NER) and RNA polymerase II transcription. Mutations or dysregulation of GTF2H3 are associated with various disorders, including Xeroderma Pigmentosum (XP), a rare genetic condition characterized by heightened sensitivity to UV radiation and increased cancer risk. The study of GTF2H3 recombinant proteins has gained significant attention as researchers seek to elucidate its function, interactions, and mechanisms of action within cellular pathways. Understanding GTF2H3's role is crucial not only for elucidating the molecular basis of related diseases but also for exploring potential therapeutic avenues for treatment and prevention. Techniques such as protein expression in various host systems, structural characterization using X-ray crystallography or NMR, and functional assays to investigate its enzymatic activity and interactions with other NER components and transcription factors are instrumental in uncovering the multifaceted roles of GTF2H3. This research is vital for advancing our understanding of genomic stability and the intricate processes governing gene expression, with implications for cancer biology and therapeutic intervention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US