Analytical Data
-
Gene name
GUCA1A
- Application
-
Alternative Names
GUCA1A; C6orf131; GCAP; GCAP1; GUCA1; Guanylyl cyclase-activating protein 1; GCAP 1; Guanylate cyclase activator 1A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43080
-
Expression Region
1-201aa
-
AA Sequence
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
-
Molecular Weight
47.85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GUCA1A (Guanylate Cyclase-Activating Protein 1A) is a crucial protein involved in the phototransduction cascade in retinal photoreceptor cells. Mutations in the GUCA1A gene can lead to various inherited retinal disorders, including cone-rod dystrophy and retinitis pigmentosa, which contribute to progressive vision loss. The significance of GUCA1A lies in its role as a modulator of photoreceptor signal transduction by regulating the activity of guanylate cyclase, an enzyme responsible for converting GTP to cGMP, thus playing an essential role in photoreceptor recovery. Studying recombinant GUCA1A proteins enables researchers to examine the structure-function relationships and the impact of pathogenic mutations on the protein's activity. Through the expression and purification of GUCA1A in heterologous systems, scientists can conduct biophysical and biochemical assays to characterize the protein's functional properties and interaction with other components of the phototransduction pathway. This research is pivotal for understanding the molecular mechanisms underlying retinal diseases and for developing potential therapeutic strategies, such as gene therapy or small-molecule compounds aimed at restoring normal protein function in affected individuals.
