Analytical Data
-
Gene name
Itgbl1
- Application
-
Alternative Names
Itgbl1；OSCP；TIED；Integrin beta-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95965
-
Expression Region
24-494aa
-
AA Sequence
VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
-
Molecular Weight
56.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Itgbl1, or integrin beta-like 1, is a protein implicated in various biological processes, including cell adhesion, migration, and signal transduction. The study of Itgbl1 has gained attention due to its potential roles in cancer progression, inflammation, and tissue repair. Research has shown that Itgbl1 is involved in regulating the tumor microenvironment and influencing immune responses, making it an important target for therapeutic intervention. The protein is predominantly expressed in certain tissues and can modulate the interaction between cells and the extracellular matrix, which is critical for maintaining tissue architecture and function. Moreover, aberrant expression of Itgbl1 has been associated with several pathological conditions, indicating its relevance in both disease mechanisms and as a biomarker for diagnosis or prognosis. Advances in recombinant protein technology have enabled the production of Itgbl1, facilitating detailed studies on its structure, function, and interactions with other molecules. Understanding the role of Itgbl1 in disease processes can pave the way for new treatment strategies, particularly in oncology and regenerative medicine. The ongoing research on Itgbl1 is expected to reveal further insights into its biological significance and potential applications in therapeutic developments.
