Analytical Data
-
Gene name
GAP43
- Application
-
Alternative Names
GAP43；GJAL;Gap junction alpha-1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17677
-
Expression Region
1-238aa
-
AA Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKK LKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDE PGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDN SPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETG ESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GAP43, or Growth Associated Protein 43, is a pivotal neuronal protein involved in various aspects of neuronal development, growth cone formation, and synaptic plasticity. It is critical for axonal growth and regeneration, making it a significant focus in neurobiology and regenerative medicine. Studies have shown that GAP43 is upregulated during neuronal injury, suggesting its role in the cellular response to damage and its potential as a repair mechanism. Researchers have been interested in generating recombinant GAP43 protein to investigate its cellular functions, binding interactions, and impact on neuronal signaling pathways. Recombinant GAP43 facilitates detailed in vitro studies, enabling the exploration of its structural properties and functional dynamics. The development of GAP43 fusion proteins has also opened avenues for therapeutic applications, particularly in enhancing nerve regeneration. Understanding GAP43's mechanisms can provide insights into neurodegenerative diseases and pave the way for innovative treatments aimed at promoting neural repair and recovery.
