Analytical Data
-
Gene name
PMT1
- Application
-
Alternative Names
PMT1；MYT1；Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P33775
-
Expression Region
292-584aa
-
AA Sequence
HFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLL
-
Molecular Weight
39.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMT1 recombinant protein has garnered significant interest due to its potential applications in various fields, particularly in biotechnology and medicine. PMT1, or Protein Methyltransferase 1, is involved in the methylation of proteins, a crucial post-translational modification that influences protein function, interactions, and stability. Dysregulation of methylation processes has been implicated in several diseases, including cancer, making PMT1 a target for therapeutic interventions. The study of PMT1 recombinant protein focuses on understanding its structure and function, enabling researchers to explore its role in cellular processes. By producing PMT1 in a recombinant form, scientists aim to characterize its enzymatic activity, identify its substrates, and elucidate the pathways influenced by its activity. In addition, the ability to generate large quantities of PMT1 recombinantly allows for the development of specific inhibitors or activators, providing tools for further research into its biological functions. Furthermore, the exploration of PMT1 in different biological contexts can reveal new insights into its potential as a biomarker for disease progression or response to treatment, thus paving the way for innovative strategies in precision medicine. Overall, the study of PMT1 recombinant protein holds promise for advancing our understanding of protein methylation and its implications in health and disease.
