Analytical Data
-
Gene name
HMGB2
- Application
-
Alternative Names
HMGB2;HMG2;High mobility group Protein B2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26583
-
Expression Region
1-209aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMGB2 (High Mobility Group Box 2) is a non-histone chromatin-binding protein that plays a crucial role in various biological processes, including gene expression, DNA repair, and cell differentiation. As a member of the high mobility group protein family, HMGB2 is involved in the architecture of chromatin and the regulation of transcription by bending DNA to facilitate the binding of transcription factors. Dysregulation of HMGB2 expression has been linked to several diseases, including cancer, where it can contribute to tumor progression and metastasis. Researchers have increasingly focused on the characterization of recombinant HMGB2 protein to elucidate its molecular functions and interactions within the cellular context. The production of recombinant HMGB2 in bacterial or eukaryotic systems allows for the generation of sufficient quantities of pure protein, facilitating in vitro and in vivo studies. These investigations are vital for understanding the protein’s role in chromatin dynamics and its potential as a therapeutic target. Moreover, given its involvement in the immune response and inflammation, recombinant HMGB2 studies are also exploring its role as a damage-associated molecular pattern (DAMP) that activates immune signaling pathways. Overall, research into HMGB2 and its recombinant forms is pivotal for advancing our understanding of fundamental cellular processes and developing novel strategies for disease treatment and prevention.
