Cat: PA2000-204DB

Recombinant Human IL8Rb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL8Rb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL8Rb;IL8RB;C-X-C chemokine receptor type 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25025

  • Expression Region

    1-360aa

  • AA Sequence

    MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF VVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALT LPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVH ATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDM GNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAM RVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVG SSSGHTSTTL

  • Molecular Weight

    66 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-8 receptor beta (IL8Rb), also known as CXCR2, is a key chemokine receptor primarily involved in the immune response and inflammation. It serves as a binding site for interleukin-8 (IL-8) and other CXC chemokines, playing a critical role in the recruitment and activation of neutrophils during inflammatory processes. Research into IL8Rb recombinant protein is essential for understanding its structural and functional properties, as well as its role in various diseases, including cancer, chronic inflammatory conditions, and autoimmune disorders. By producing IL8Rb as a recombinant protein, scientists can study the receptor's signaling pathways, investigate potential ligand-receptor interactions, and develop therapeutic strategies to modulate its function. Furthermore, IL8Rb has emerged as a target for drug development, with the potential to develop antagonists that can inhibit its activity and thereby mitigate detrimental inflammatory responses. Such research is crucial in the context of developing novel treatments for diseases characterized by excessive neutrophil recruitment and inflammation, paving the way for targeted therapies that could improve patient outcomes. Understanding the molecular mechanisms underlying IL8Rb function will not only provide insights into the complexities of the immune system but also contribute to the advancement of precision medicine approaches in treating inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US