Analytical Data
-
Gene name
IL13RA1
- Application
-
Alternative Names
IL13RA1;IL13R;IL13RA;Interleukin-13 receptor subunit alpha-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78552
-
Expression Region
22-343aa
-
AA Sequence
GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG DKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPP EGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIH QCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVP LTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTET HNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCY EDDKLWSNWSQEMSIGKKRNST
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL13RA1, or Interleukin 13 Receptor Alpha 1, is a critical component of the interleukin-13 (IL-13) receptor complex, which plays a significant role in various biological processes, including immune response and inflammation. Abnormal expression or function of IL13RA1 has been implicated in several diseases, particularly in allergic conditions, asthma, and certain types of cancer. The receptor is known for mediating the effects of IL-13, a cytokine involved in Th2 immune responses, and its interaction with IL-4, suggesting its relevance in modulating immune responses. Research into IL13RA1 recombinant proteins has gained traction as they offer valuable insights into the underlying mechanisms of IL-13 signaling and its impact on disease. These recombinant proteins can be utilized in various experimental setups, from studying receptor binding affinities to exploring downstream signaling pathways. Furthermore, IL13RA1's potential as a therapeutic target has sparked interest in developing novel treatments for diseases characterized by dysregulated IL-13 signaling. Understanding the functional properties of IL13RA1 through recombinant proteins not only enhances our comprehension of its role in pathophysiology but also paves the way for innovative therapeutic strategies aimed at modulating IL-13 related pathways for clinical benefit. Overall, research on IL13RA1 recombinant proteins is essential for elucidating the complexities of immune regulation and for the potential development of targeted therapies in allergic diseases and beyond.











