Analytical Data
-
Gene name
Tnfrsf10b
- Application
-
Alternative Names
Tnfrsf10b；DR5；KILLER；TRAILR2；Tumor necrosis factor receptor superfamily member 10B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14763
-
Expression Region
56-182aa
-
AA Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
-
Molecular Weight
15.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF10B, also known as death receptor 5 (DR5), is a member of the tumor necrosis factor receptor superfamily and plays a crucial role in mediating programmed cell death (apoptosis) in response to the binding of its ligand, TRAIL (TNF-related apoptosis-inducing ligand). Research into TNFRSF10B has garnered significant attention due to its potential therapeutic implications in cancer treatment. Tumor cells often develop resistance to apoptosis, which contributes to cancer progression and treatment failure. DR5, by facilitating TRAIL-induced apoptosis, is a promising target for developing cancer therapies aimed at selectively inducing death in malignant cells while sparing normal tissues. Furthermore, recombinant forms of TNFRSF10B have been explored for their ability to enhance TRAIL's effectiveness, allowing for the development of novel treatments that can overcome resistance mechanisms. Studies have shown that upregulating DR5 expression in cancer cells can sensitize these cells to TRAIL-mediated apoptosis, paving the way for combination therapies that may include DR5 agonists or recombinant TNFRSF10B proteins. Given its diverse functions in immune regulation and its role in tumor biology, understanding the mechanisms governing TNFRSF10B signaling and its interactions with TRAIL is vital for advancing therapeutic strategies. Therefore, the investigation of recombinant TNFRSF10B not only aids in elucidating its biological functions but also holds great promise for the development of targeted cancer therapies that capitalize on its apoptotic signaling pathway.
