Analytical Data
-
Gene name
MICA
- Application
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q29983
-
Expression Region
24-308aa
-
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWA EDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHE DNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDA MKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITV TCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRIC QGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MICA (MHC class I polypeptide-related sequence A) is a crucial protein involved in the immune response, particularly in the activation of natural killer (NK) cells. It is a stress-induced ligand that interacts with the NKG2D receptor on NK cells, facilitating their recognition and elimination of stressed, infected, or transformed cells. Research on MICA has gained significant attention due to its implications in cancer immunotherapy, transplantation, and autoimmune diseases. Variations in MICA expression can influence an individual's susceptibility to diseases and overall immune response. The ability to produce recombinant MICA proteins has become essential for studying its structure-function relationships, interactions with its receptors, and potential therapeutic applications. Scientists aim to elucidate the exact mechanisms by which MICA modulates immune responses and to explore its role in tumor surveillance. Additionally, investigations into the genetic regulation of MICA expression and its polymorphisms contribute to understanding ethnic and individual differences in immune responses. Overall, the recombinant production of MICA proteins not only enhances our understanding of immune regulation but also paves the way for the development of novel immunotherapeutic strategies.
