Analytical Data
-
Gene name
IL1R1
- Application
-
Alternative Names
IL1R1;IL1R;IL1RA;IL1RT1;Interleukin-1 receptor type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14778
-
Expression Region
21-338aa
-
AA Sequence
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLD NIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEE NKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDED DPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI DAAYIQLIYPVT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL1R1, or Interleukin 1 Receptor Type 1, is a crucial component of the interleukin-1 signaling pathway, which plays a significant role in mediating inflammatory responses. As a receptor for interleukin-1 (IL-1), a pro-inflammatory cytokine, IL1R1 is involved in various biological processes, including cell proliferation, differentiation, and apoptosis. Dysregulation of IL1R1 signaling has been implicated in a range of inflammatory diseases, autoimmune disorders, and even cancer. The recombinant expression of IL1R1 protein is essential for advancing our understanding of its structure-function relationships and facilitating the development of therapeutic agents targeting IL-1 mediated pathways. Researchers have been focusing on producing recombinant IL1R1 to study its interaction with ligands and downstream signaling mechanisms, as well as to investigate its potential as a therapeutic target. The availability of purified IL1R1 protein allows for in-depth biochemical assays and structural studies, which can elucidate how mutations or alterations in this receptor may influence disease progression. Moreover, the recombinant protein can serve as a valuable tool in drug discovery processes aimed at developing IL-1 inhibitors for treating various inflammatory conditions. Understanding the role and functioning of IL1R1 through its recombinant protein form holds promise for identifying novel therapeutic strategies and enhancing our overall grasp of inflammatory diseases.











