Analytical Data
-
Gene name
FNDC3B
- Application
-
Alternative Names
FNDC3B；FAD104；NS5ABP37；Fibronectin type III domain-containing Protein 3B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53EP0
-
Expression Region
278-570aa
-
AA Sequence
GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FNDC3B, a member of the fibronectin type III domain-containing protein family, is emerging as a significant player in various biological processes, including cell adhesion, differentiation, and signaling pathways. Its expression has been linked to several important physiological functions and pathological conditions, particularly in cancer and metabolic disorders. Research indicates that FNDC3B may have roles in modulating immune responses and influencing tumor microenvironments, suggesting its potential as a therapeutic target. Recent studies have focused on the recombinant expression of FNDC3B to facilitate detailed investigations into its structure-function relationships and interactions at the molecular level. By generating FNDC3B recombinant proteins, researchers aim to characterize its biological activities, explore its potential as a biomarker for disease progression, and evaluate its utility in drug development. Understanding the mechanisms by which FNDC3B exerts its effects may provide insights into novel therapeutic strategies for targeting associated diseases, making it a compelling subject for ongoing research in molecular biology and medicine.
