Analytical Data
-
Gene name
KLF8
- Application
-
Alternative Names
Basic krueppel-like factor 3; BKLF3; DXS741; KLF8; KLF8_HUMAN; Krueppel-like factor 8; Kruppel like factor 8; MGC138314; Zinc finger protein 741; ZNF741
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95600
-
Expression Region
1-359aa
-
AA Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM
-
Molecular Weight
65.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLF8, a member of the Krüppel-like factor (KLF) family of transcription factors, has garnered significant attention in recent years due to its pivotal role in regulating cellular processes such as proliferation, differentiation, and apoptosis. The KLF family is implicated in various biological functions, and KLF8, in particular, is known to be involved in inflammatory responses, embryonic development, and tumorigenesis. Aberrant expression of KLF8 has been associated with several human cancers, suggesting that it may act as an oncogene. Research has shown that KLF8 can enhance cell invasion and metastasis, making it a potential target for therapeutic intervention. To better understand KLF8's mechanisms of action, scientists have sought to produce recombinant KLF8 protein, enabling investigations into its structural features, DNA-binding properties, and interaction with other proteins. This research is crucial for elucidating the pathways through which KLF8 exerts its effects, thereby providing insights into its role in cancer biology and potential implications for targeted therapies. High-level production of recombinant KLF8, utilizing techniques such as bacterial or mammalian expression systems, allows for extensive biochemical and biophysical analyses that can shed light on its functions and therapeutic potential. Overall, the study of recombinant KLF8 protein is expected to advance our knowledge of this critical regulator and its contributions to disease processes, ultimately leading to novel strategies for cancer diagnosis and treatment.
