Analytical Data
-
Gene name
MAGEA4
- Application
-
Alternative Names
MAGEA4;MAGE4;Melanoma-associated antigen 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43358
-
Expression Region
1-317aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSEQKSQHCKPEEGVEAQEEALGLVGAQA PTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGASALPTTISFTC WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKEL VTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLV TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMG VYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEA4 (Melanoma Antigen Gene A4) is a member of the MAGE gene family, which encodes tumor-specific antigens that are predominantly expressed in various types of cancer, particularly melanoma. The study of MAGEA4 has gained significant attention due to its potential as a target for cancer immunotherapy. Unlike normal tissues, MAGEA4 is expressed in the testis and certain tumors, making it an ideal candidate for cancer vaccine development and adoptive T-cell therapies. Research has shown that MAGEA4 can elicit robust immune responses, leading to the investigation of its role in T-cell activation and recognition. The recombinant expression of MAGEA4 protein facilitates the characterization of its structure, immune properties, and interactions with the immune system, thus allowing for the identification of MAGEA4-derived epitopes that can be targeted by cytotoxic T lymphocytes. Additionally, studies have explored the potential of MAGEA4 in combination therapies, enhancing the effectiveness of other oncological treatments. As a result, MAGEA4 stands out as a promising immunotherapeutic target, with ongoing research aimed at understanding its mechanisms of action and optimizing strategies for harnessing the immune response against MAGEA4-expressing tumors. Overall, the exploration of MAGEA4 recombinant protein not only contributes to cancer vaccine research but also paves the way for innovative approaches in cancer treatment by enhancing the specificity and effectiveness of immunotherapies.
