Analytical Data
-
Gene name
KLRF1
- Application
-
Alternative Names
KLRF1; CLEC5C; MLKiller cell lectin-like receptor subfamily F member 1; Lectin-like receptor F1; Activating coreceptor NKp80; C-type lectin domain family 5 member C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZS2
-
Expression Region
1-124aa
-
AA Sequence
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVPRPHFRLLYRKT
-
Molecular Weight
40.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLRF1, also known as Killer Cell Lectin-like Receptor F1, is a member of the C-type lectin-like receptor family and plays a significant role in the immune response, particularly in natural killer (NK) cell function. The receptor is primarily expressed on the surface of NK cells and has been implicated in the regulation of immune surveillance, tumor recognition, and the modulation of autoimmune diseases. Research has shown that KLRF1 can interact with various ligands, affecting NK cell activation and cytokine production. Its ability to recognize altered self-cells, such as those that have downregulated major histocompatibility complex (MHC) molecules, is crucial for effective anti-tumor immunity. Understanding the structure and function of KLRF1 is vital for the development of immunotherapies and vaccine strategies. Studies involving the recombinant expression of KLRF1 have been essential in elucidating its interactions and mechanisms of action, providing insights into how it can be manipulated to enhance immune responses against cancers and improve therapeutic outcomes. Additionally, the exploration of KLRF1's role in different pathological conditions underscores its potential as a biomarker and therapeutic target, making it a focus of ongoing research in immunology and cancer therapy. By further investigating KLRF1, researchers aim to uncover novel strategies for enhancing NK cell-mediated cytotoxicity and improving patient responses to existing therapies.
