Analytical Data
-
Gene name
KPTN
- Application
-
Alternative Names
2E4; actin associated protein 2E4; actin binding protein; Actin-associated protein 2E4; Kaptin; Kptn; KPTN protein; KPTN_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y664
-
Expression Region
1-436aa
-
AA Sequence
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS
-
Molecular Weight
73.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KPTN (Kaposi's sarcoma-associated herpesvirus (KSHV) potential tumor necrosis factor receptor) is a protein implicated in various cellular processes, including cell growth, differentiation, and apoptosis. Its study has gained attention due to its potential role in oncogenesis, particularly in the context of KSHV, a virus associated with several malignancies such as Kaposi's sarcoma, primary effusion lymphoma, and multicentric Castleman's disease. Understanding the structure and function of KPTN can shed light on the mechanisms through which KSHV influences host cell behavior and contributes to tumor development. Recent advancements in molecular biology and structural biology techniques have facilitated the characterization of KPTN, revealing its interactions with other cellular proteins and its involvement in signaling pathways. Furthermore, KPTN may serve as a target for therapeutic interventions aimed at mitigating the effects of KSHV-related cancers. Given the increasing incidence of KSHV-associated diseases worldwide, research into KPTN is critical for developing innovative strategies for prevention and treatment.
