Analytical Data
-
Gene name
MAT2B
- Application
-
Alternative Names
MAT2B;TGR;Methionine adenosyltransferase 2 subunit beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZL9
-
Expression Region
2-334aa
-
AA Sequence
VGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQN NWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDV VENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREED IPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMF DKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWS GNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLE TLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAT2B, or Methionine Adenosyltransferase 2B, is a critical enzyme involved in the biosynthesis of S-adenosylmethionine (SAM), a pivotal methyl donor in various biological processes, including methylation of DNA, RNA, and proteins. The enzyme has garnered considerable research interest due to its role in cellular metabolism, regulation of gene expression, and involvement in neurodegenerative diseases, such as Alzheimer's and Parkinson's. Alterations in MAT2B expression have been linked to cognitive decline and neuroinflammation, highlighting its potential as a therapeutic target. Furthermore, MAT2B has been found to possess protective effects against oxidative stress and is thought to play a role in maintaining neuronal health. The investigation of MAT2B as a recombinant protein allows researchers to explore its enzymatic properties, interaction with other biomolecules, and its potential implications in disease treatment and prevention. By further elucidating the structure-function relationships of MAT2B, researchers aim to harness its biological activities for drug development and therapeutic strategies, paving the way for innovations in treating conditions associated with SAM metabolism dysregulation. As a result, MAT2B recombinant protein studies are vital for understanding its biological functions and exploring its therapeutic possibilities in both neuroprotection and metabolic regulation.
