Analytical Data
-
Gene name
KRCC1
- Application
-
Alternative Names
KRCC1; CHBP2; BM-003; BM-044Lysine-rich coiled-coil protein 1; Cryptogenic hepatitis-binding protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPI7
-
Expression Region
1-259aa
-
AA Sequence
MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVSTEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF
-
Molecular Weight
57.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRCC1 (Kinase-regulated protein phosphatase complex subunit 1) is a protein that has garnered significant interest in the field of biomedical research due to its potential role in various cellular processes, including cell signaling, proliferation, and apoptosis. Studies have indicated that KRCC1 may be involved in the regulation of kinase activity, influencing pathways that are crucial for maintaining cellular homeostasis and responding to external stimuli. Dysregulation of KRCC1 expression or function has been linked to several diseases, including various cancers, making it a candidate for therapeutic targeting. Furthermore, the ability to produce recombinant KRCC1 protein has opened avenues for in-depth studies of its structure, function, and interactions with other cellular components. Researchers aim to elucidate the mechanistic pathways involving KRCC1 and explore its potential as a biomarker or therapeutic target, thus advancing our understanding of its role in health and disease. The recombinant protein also serves as a valuable tool for drug discovery and the development of novel therapeutic strategies aimed at mitigating disorders associated with its dysregulation.
